Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613

  1. Avatar for Beany 91. Beany Lv 1 2 pts. 11,225
  2. Avatar for rezaefar 92. rezaefar Lv 1 2 pts. 11,223
  3. Avatar for sitlux 93. sitlux Lv 1 2 pts. 11,205
  4. Avatar for Bearpaw 94. Bearpaw Lv 1 2 pts. 11,192
  5. Avatar for zo3xiaJonWeinberg 95. zo3xiaJonWeinberg Lv 1 2 pts. 11,187
  6. Avatar for alwen 96. alwen Lv 1 2 pts. 11,157
  7. Avatar for Philzord 97. Philzord Lv 1 2 pts. 11,131
  8. Avatar for SHK5P 98. SHK5P Lv 1 2 pts. 11,126
  9. Avatar for rabamino12358 99. rabamino12358 Lv 1 2 pts. 11,111
  10. Avatar for HelixHealer91 100. HelixHealer91 Lv 1 1 pt. 11,109

Comments