Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613

  1. Avatar for donuts554 101. donuts554 Lv 1 1 pt. 11,105
  2. Avatar for Kevonni 102. Kevonni Lv 1 1 pt. 11,067
  3. Avatar for cjddig 103. cjddig Lv 1 1 pt. 11,063
  4. Avatar for drumpeter18yrs9yrs 104. drumpeter18yrs9yrs Lv 1 1 pt. 11,058
  5. Avatar for tzugypsyl 105. tzugypsyl Lv 1 1 pt. 11,045
  6. Avatar for Deet 106. Deet Lv 1 1 pt. 11,043
  7. Avatar for AlkiP0Ps 107. AlkiP0Ps Lv 1 1 pt. 11,030
  8. Avatar for Jester_sunday 108. Jester_sunday Lv 1 1 pt. 11,007
  9. Avatar for Mike Lewis 109. Mike Lewis Lv 1 1 pt. 10,976
  10. Avatar for Amitron 110. Amitron Lv 1 1 pt. 10,972

Comments