Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613

  1. Avatar for MrDuck09 131. MrDuck09 Lv 1 1 pt. 9,786
  2. Avatar for Giold 132. Giold Lv 1 1 pt. 9,742
  3. Avatar for stomjoh 133. stomjoh Lv 1 1 pt. 9,571
  4. Avatar for rinze 134. rinze Lv 1 1 pt. 9,505
  5. Avatar for pfeiffelfloyd 135. pfeiffelfloyd Lv 1 1 pt. 8,446
  6. Avatar for ProfVince 136. ProfVince Lv 1 1 pt. 8,290
  7. Avatar for dahast.de 137. dahast.de Lv 1 1 pt. 8,161
  8. Avatar for 81189h 138. 81189h Lv 1 1 pt. 8,079
  9. Avatar for Mohoernchen 139. Mohoernchen Lv 1 1 pt. 7,914
  10. Avatar for DKathi 140. DKathi Lv 1 1 pt. 7,717

Comments