Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613

  1. Avatar for RockOn 141. RockOn Lv 1 1 pt. 7,717
  2. Avatar for SaraL 142. SaraL Lv 1 1 pt. 7,717
  3. Avatar for surrealchemist 143. surrealchemist Lv 1 1 pt. 7,717
  4. Avatar for Dora2199 144. Dora2199 Lv 1 1 pt. 7,717
  5. Avatar for dd-2 145. dd-2 Lv 1 1 pt. 7,487
  6. Avatar for jawz101 146. jawz101 Lv 1 1 pt. 7,467
  7. Avatar for kevin everington 147. kevin everington Lv 1 1 pt. 7,343
  8. Avatar for tomespen 148. tomespen Lv 1 1 pt. 7,333
  9. Avatar for Merf 149. Merf Lv 1 1 pt. 6,799
  10. Avatar for jsfoldingaccount 150. jsfoldingaccount Lv 1 1 pt. 6,613

Comments