Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613

  1. Avatar for georg137 11. georg137 Lv 1 74 pts. 11,819
  2. Avatar for Deleted player 12. Deleted player 71 pts. 11,817
  3. Avatar for jausmh 13. jausmh Lv 1 69 pts. 11,813
  4. Avatar for MicElephant 14. MicElephant Lv 1 67 pts. 11,808
  5. Avatar for dcrwheeler 15. dcrwheeler Lv 1 65 pts. 11,799
  6. Avatar for mirp 16. mirp Lv 1 62 pts. 11,793
  7. Avatar for Tygh 17. Tygh Lv 1 60 pts. 11,786
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 58 pts. 11,785
  9. Avatar for robgee 19. robgee Lv 1 56 pts. 11,783
  10. Avatar for Aubade01 20. Aubade01 Lv 1 55 pts. 11,781

Comments