Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613

  1. Avatar for Pazithi 21. Pazithi Lv 1 53 pts. 11,778
  2. Avatar for Deleted player 22. Deleted player pts. 11,768
  3. Avatar for NinjaGreg 23. NinjaGreg Lv 1 49 pts. 11,758
  4. Avatar for christioanchauvin 24. christioanchauvin Lv 1 47 pts. 11,745
  5. Avatar for johnmitch 25. johnmitch Lv 1 46 pts. 11,742
  6. Avatar for g_b 26. g_b Lv 1 44 pts. 11,738
  7. Avatar for Bruno Kestemont 27. Bruno Kestemont Lv 1 43 pts. 11,738
  8. Avatar for spmm 28. spmm Lv 1 41 pts. 11,733
  9. Avatar for lynnai 29. lynnai Lv 1 40 pts. 11,727
  10. Avatar for Blipperman 30. Blipperman Lv 1 38 pts. 11,718

Comments