Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613

  1. Avatar for ucad 31. ucad Lv 1 37 pts. 11,718
  2. Avatar for nicobul 32. nicobul Lv 1 36 pts. 11,716
  3. Avatar for KarenCH 33. KarenCH Lv 1 34 pts. 11,691
  4. Avatar for phi16 34. phi16 Lv 1 33 pts. 11,687
  5. Avatar for fiendish_ghoul 35. fiendish_ghoul Lv 1 32 pts. 11,683
  6. Avatar for silent gene 36. silent gene Lv 1 31 pts. 11,676
  7. Avatar for drjr 37. drjr Lv 1 29 pts. 11,672
  8. Avatar for guineapig 38. guineapig Lv 1 28 pts. 11,671
  9. Avatar for Skippysk8s 39. Skippysk8s Lv 1 27 pts. 11,668
  10. Avatar for John McLeod 40. John McLeod Lv 1 26 pts. 11,647

Comments