Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613

  1. Avatar for abiogenesis 51. abiogenesis Lv 1 17 pts. 11,550
  2. Avatar for Anfinsen_slept_here 52. Anfinsen_slept_here Lv 1 16 pts. 11,547
  3. Avatar for Lotus23 53. Lotus23 Lv 1 15 pts. 11,537
  4. Avatar for pvc78 54. pvc78 Lv 1 15 pts. 11,537
  5. Avatar for grogar7 55. grogar7 Lv 1 14 pts. 11,526
  6. Avatar for fpc 56. fpc Lv 1 13 pts. 11,525
  7. Avatar for aznarog 57. aznarog Lv 1 13 pts. 11,501
  8. Avatar for Gwendolym 58. Gwendolym Lv 1 12 pts. 11,489
  9. Avatar for alcor29 59. alcor29 Lv 1 12 pts. 11,485
  10. Avatar for spdenne 60. spdenne Lv 1 11 pts. 11,480

Comments