Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613

  1. Avatar for kyoota 61. kyoota Lv 1 11 pts. 11,474
  2. Avatar for Todd6485577 62. Todd6485577 Lv 1 10 pts. 11,474
  3. Avatar for Czim 63. Czim Lv 1 10 pts. 11,473
  4. Avatar for hansvandenhof 64. hansvandenhof Lv 1 9 pts. 11,468
  5. Avatar for heather-1 65. heather-1 Lv 1 9 pts. 11,463
  6. Avatar for tracybutt 66. tracybutt Lv 1 9 pts. 11,442
  7. Avatar for jamiexq 67. jamiexq Lv 1 8 pts. 11,439
  8. Avatar for HuubR 68. HuubR Lv 1 8 pts. 11,434
  9. Avatar for fishercat 69. fishercat Lv 1 7 pts. 11,432
  10. Avatar for puxatudo 70. puxatudo Lv 1 7 pts. 11,401

Comments