Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups


  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613

  1. Avatar for pfirth 71. pfirth Lv 1 7 pts. 11,381
  2. Avatar for GuR0 72. GuR0 Lv 1 6 pts. 11,378
  3. Avatar for Pawel Tluscik 73. Pawel Tluscik Lv 1 6 pts. 11,373
  4. Avatar for Glen B 74. Glen B Lv 1 6 pts. 11,361
  5. Avatar for Keresto 75. Keresto Lv 1 5 pts. 11,347
  6. Avatar for pandapharmd 76. pandapharmd Lv 1 5 pts. 11,339
  7. Avatar for Evica 77. Evica Lv 1 5 pts. 11,331
  8. Avatar for Deleted player 78. Deleted player pts. 11,326
  9. Avatar for infjamc 79. infjamc Lv 1 4 pts. 11,318
  10. Avatar for xx7hanni 80. xx7hanni Lv 1 4 pts. 11,312

Comments