Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups

  1. Avatar for hhv9 11. hhv9 1 pt. 11,312
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 11,260
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,259
  4. Avatar for Team Canada 14. Team Canada 1 pt. 11,192
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 10,939
  6. Avatar for Boilermakers 16. Boilermakers 1 pt. 3,613
  1. Avatar for fearjuan 81. fearjuan Lv 1 4 pts. 11,309
  2. Avatar for Visok 82. Visok Lv 1 4 pts. 11,304
  3. Avatar for bcre8tvv 83. bcre8tvv Lv 1 4 pts. 11,297
  4. Avatar for dldahlen 84. dldahlen Lv 1 3 pts. 11,291
  5. Avatar for aqsw 85. aqsw Lv 1 3 pts. 11,284
  6. Avatar for aendgraend 86. aendgraend Lv 1 3 pts. 11,260
  7. Avatar for ShadowTactics 87. ShadowTactics Lv 1 3 pts. 11,259
  8. Avatar for xbp 88. xbp Lv 1 3 pts. 11,250
  9. Avatar for CAN1958 89. CAN1958 Lv 1 3 pts. 11,231
  10. Avatar for Sadaharu06.jp 90. Sadaharu06.jp Lv 1 3 pts. 11,229

Comments