Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,035
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 11,920
  3. Avatar for Contenders 3. Contenders 49 pts. 11,897
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,857
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 11,850
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,813
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 11,778
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 11,733
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 11,611
  10. Avatar for Russian team 10. Russian team 2 pts. 11,474
  1. Avatar for apetrux 121. apetrux Lv 1 1 pt. 10,794
  2. Avatar for hada 122. hada Lv 1 1 pt. 10,789
  3. Avatar for felimare 123. felimare Lv 1 1 pt. 10,759
  4. Avatar for harvardman 124. harvardman Lv 1 1 pt. 10,641
  5. Avatar for Steve-ATeam 125. Steve-ATeam Lv 1 1 pt. 10,626
  6. Avatar for DipsyDoodle2016 126. DipsyDoodle2016 Lv 1 1 pt. 10,573
  7. Avatar for LetsSolveThis 127. LetsSolveThis Lv 1 1 pt. 10,371
  8. Avatar for teunlammetje 128. teunlammetje Lv 1 1 pt. 10,227
  9. Avatar for equilibria 129. equilibria Lv 1 1 pt. 10,165
  10. Avatar for joremen 130. joremen Lv 1 1 pt. 9,932

Comments