Placeholder image of a protein
Icon representing a puzzle

1872: Refinement Puzzle: R1074

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 31, 2020
Expires
Max points
100
Description

THIS IS A MULTISTART PUZZLE - Click "RESET PUZZLE" to cycle through both starting structures. CASP14 has released another refinement target with 2 different starting structures. They did not reveal the accuracy of either starting model, but we do know that they are both incorrect. Try to explore far enough away from both starting structures, as the highest-scoring folds might be far away from both starts!


Sequence:


NDFVSRLKALDGREGKIVSSYDDENTGRCRLELQKYELEDGSQGLAVYLQDTGMYFTPSAGLDKETKLKDANTAVVSTSSERPGGDACGDFGGALGYKKVLVLKDNQVTIRETFRCVMDGFKKYDLSTTCQF

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,035
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 11,920
  3. Avatar for Contenders 3. Contenders 49 pts. 11,897
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 33 pts. 11,857
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 11,850
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 11,813
  7. Avatar for Gargleblasters 7. Gargleblasters 8 pts. 11,778
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 11,733
  9. Avatar for Hold My Beer 9. Hold My Beer 3 pts. 11,611
  10. Avatar for Russian team 10. Russian team 2 pts. 11,474
  1. Avatar for fisherlr777 151. fisherlr777 Lv 1 1 pt. 6,082
  2. Avatar for Ashrai 152. Ashrai Lv 1 1 pt. 6,065
  3. Avatar for Mike Cassidy 153. Mike Cassidy Lv 1 1 pt. 5,620
  4. Avatar for DScott 154. DScott Lv 1 1 pt. 5,487
  5. Avatar for Mateo Ian 155. Mateo Ian Lv 1 1 pt. 4,943
  6. Avatar for Swapper242 156. Swapper242 Lv 1 1 pt. 4,935
  7. Avatar for Thinlizard 157. Thinlizard Lv 1 1 pt. 4,830
  8. Avatar for spantham 158. spantham Lv 1 1 pt. 4,663
  9. Avatar for mdomingo 159. mdomingo Lv 1 1 pt. 3,613
  10. Avatar for StaHoll 160. StaHoll Lv 1 1 pt. 2,234

Comments