Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,553
  2. Avatar for Deleted player 2. Deleted player 74 pts. 11,495
  3. Avatar for LociOiling 3. LociOiling Lv 1 54 pts. 11,492
  4. Avatar for alwen 4. alwen Lv 1 38 pts. 11,471
  5. Avatar for mirp 5. mirp Lv 1 27 pts. 11,465
  6. Avatar for RockOn 6. RockOn Lv 1 18 pts. 11,463
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 12 pts. 11,459
  8. Avatar for silent gene 8. silent gene Lv 1 8 pts. 11,453
  9. Avatar for fishercat 9. fishercat Lv 1 5 pts. 11,448
  10. Avatar for CharlieFortsConscience 10. CharlieFortsConscience Lv 1 3 pts. 11,431

Comments