Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 11,553
  2. Avatar for Deleted player 2. Deleted player 74 pts. 11,495
  3. Avatar for LociOiling 3. LociOiling Lv 1 54 pts. 11,492
  4. Avatar for alwen 4. alwen Lv 1 38 pts. 11,471
  5. Avatar for mirp 5. mirp Lv 1 27 pts. 11,465
  6. Avatar for RockOn 6. RockOn Lv 1 18 pts. 11,463
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 12 pts. 11,459
  8. Avatar for silent gene 8. silent gene Lv 1 8 pts. 11,453
  9. Avatar for fishercat 9. fishercat Lv 1 5 pts. 11,448
  10. Avatar for CharlieFortsConscience 10. CharlieFortsConscience Lv 1 3 pts. 11,431

Comments