1875: Refinement Puzzle: R1055
Closed since over 5 years ago
Novice Overall PredictionSummary
- Created
- August 07, 2020
- Expires
- Max points
- 100
CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!
Sequence:
GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE
Top groups
-
100 pts. 11,553
-
-
-
-
-
-
-
-
-
-
100 pts. 11,491
-
-
-
-
-
-
-
-
-