Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for Deleted player 91. Deleted player pts. 10,384
  2. Avatar for dldahlen 92. dldahlen Lv 1 2 pts. 10,377
  3. Avatar for Evica 93. Evica Lv 1 2 pts. 10,367
  4. Avatar for Kevonni 94. Kevonni Lv 1 1 pt. 10,357
  5. Avatar for Beany 95. Beany Lv 1 1 pt. 10,345
  6. Avatar for fisherlr777 96. fisherlr777 Lv 1 1 pt. 10,336
  7. Avatar for CAN1958 97. CAN1958 Lv 1 1 pt. 10,322
  8. Avatar for xbp 98. xbp Lv 1 1 pt. 10,317
  9. Avatar for pfirth 99. pfirth Lv 1 1 pt. 10,313
  10. Avatar for kludbrook 100. kludbrook Lv 1 1 pt. 10,292

Comments