Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for tlaran 121. tlaran Lv 1 1 pt. 10,033
  2. Avatar for frostschutz 122. frostschutz Lv 1 1 pt. 10,024
  3. Avatar for tzugypsyl 123. tzugypsyl Lv 1 1 pt. 10,002
  4. Avatar for Alec_C 124. Alec_C Lv 1 1 pt. 9,973
  5. Avatar for chlorowolf 125. chlorowolf Lv 1 1 pt. 9,953
  6. Avatar for lolsnipesXD 126. lolsnipesXD Lv 1 1 pt. 9,937
  7. Avatar for 81189h 127. 81189h Lv 1 1 pt. 9,933
  8. Avatar for matfer 128. matfer Lv 1 1 pt. 9,923
  9. Avatar for roman madala 129. roman madala Lv 1 1 pt. 9,917
  10. Avatar for Superphosphate 130. Superphosphate Lv 1 1 pt. 9,913

Comments