Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for lynx5864 131. lynx5864 Lv 1 1 pt. 9,894
  2. Avatar for rene1010 132. rene1010 Lv 1 1 pt. 9,891
  3. Avatar for davidoskky 133. davidoskky Lv 1 1 pt. 9,882
  4. Avatar for pattyloof 134. pattyloof Lv 1 1 pt. 9,861
  5. Avatar for Nekomoto 135. Nekomoto Lv 1 1 pt. 9,857
  6. Avatar for deathbat_87 136. deathbat_87 Lv 1 1 pt. 9,834
  7. Avatar for RyeSnake 137. RyeSnake Lv 1 1 pt. 9,833
  8. Avatar for greenturtle1134 138. greenturtle1134 Lv 1 1 pt. 9,833
  9. Avatar for chouniu 139. chouniu Lv 1 1 pt. 9,828
  10. Avatar for dahast.de 140. dahast.de Lv 1 1 pt. 9,817

Comments