Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for lraguette 71. lraguette Lv 1 5 pts. 10,591
  2. Avatar for borattt 72. borattt Lv 1 5 pts. 10,576
  3. Avatar for rezaefar 73. rezaefar Lv 1 5 pts. 10,554
  4. Avatar for hada 74. hada Lv 1 4 pts. 10,549
  5. Avatar for diamonddays 75. diamonddays Lv 1 4 pts. 10,543
  6. Avatar for Joanna_H 76. Joanna_H Lv 1 4 pts. 10,507
  7. Avatar for fishercat 77. fishercat Lv 1 4 pts. 10,491
  8. Avatar for cbwest 78. cbwest Lv 1 4 pts. 10,482
  9. Avatar for tracybutt 79. tracybutt Lv 1 3 pts. 10,479
  10. Avatar for Blipperman 80. Blipperman Lv 1 3 pts. 10,471

Comments