Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 10,825
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 10,777
  3. Avatar for SETI.Germany 13. SETI.Germany 1 pt. 10,611
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,469
  5. Avatar for Team China 15. Team China 1 pt. 9,828
  6. Avatar for Trinity Biology 16. Trinity Biology 1 pt. 9,815
  7. Avatar for Macromolecules@MQ 2020 17. Macromolecules@MQ 2020 1 pt. 8,699
  1. Avatar for Lotus23 81. Lotus23 Lv 1 3 pts. 10,469
  2. Avatar for Bearpaw 82. Bearpaw Lv 1 3 pts. 10,469
  3. Avatar for SEF830 83. SEF830 Lv 1 3 pts. 10,445
  4. Avatar for equilibria 84. equilibria Lv 1 3 pts. 10,445
  5. Avatar for kevin everington 85. kevin everington Lv 1 2 pts. 10,440
  6. Avatar for Arne Heessels 86. Arne Heessels Lv 1 2 pts. 10,426
  7. Avatar for manu8170 87. manu8170 Lv 1 2 pts. 10,425
  8. Avatar for Trajan464 88. Trajan464 Lv 1 2 pts. 10,414
  9. Avatar for zo3xiaJonWeinberg 89. zo3xiaJonWeinberg Lv 1 2 pts. 10,405
  10. Avatar for altaris 90. altaris Lv 1 2 pts. 10,403

Comments