Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,553
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,489
  4. Avatar for Go Science 4. Go Science 36 pts. 11,465
  5. Avatar for Contenders 5. Contenders 24 pts. 11,438
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,313
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,194
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 11,109
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 11,011
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 10,990
  1. Avatar for Bletchley Park 11. Bletchley Park Lv 1 2 pts. 11,430
  2. Avatar for borattt 12. borattt Lv 1 1 pt. 11,407
  3. Avatar for KarenCH 13. KarenCH Lv 1 1 pt. 11,380
  4. Avatar for alcor29 14. alcor29 Lv 1 1 pt. 11,359
  5. Avatar for georg137 15. georg137 Lv 1 1 pt. 11,350
  6. Avatar for Xartos 16. Xartos Lv 1 1 pt. 11,314
  7. Avatar for equilibria 17. equilibria Lv 1 1 pt. 11,305
  8. Avatar for Deleted player 18. Deleted player pts. 10,817

Comments