Placeholder image of a protein
Icon representing a puzzle

1875: Refinement Puzzle: R1055

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
August 07, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=59. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


GKYFSKVGSAGLKQLTNKLDINECATVDELVDEINKSGTVKRKIKNQSAFDLSRECLGYPEADFITLVNNMRFKIENCKVVNFNIENTNCLNNPSIETIYRNFNQFVSIFNVVTDVKKRLFE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,553
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 11,495
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 52 pts. 11,489
  4. Avatar for Go Science 4. Go Science 36 pts. 11,465
  5. Avatar for Contenders 5. Contenders 24 pts. 11,438
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,313
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 11,194
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 11,109
  9. Avatar for BOINC@Poland 9. BOINC@Poland 4 pts. 11,011
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 10,990
  1. Avatar for Deleted player
    1. Deleted player
    100 pts. 11,491
  2. Avatar for jobo0502 2. jobo0502 Lv 1 97 pts. 11,489
  3. Avatar for Deleted player 3. Deleted player pts. 11,477
  4. Avatar for MicElephant 4. MicElephant Lv 1 91 pts. 11,465
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 88 pts. 11,451
  6. Avatar for Xartos 6. Xartos Lv 1 85 pts. 11,445
  7. Avatar for georg137 7. georg137 Lv 1 82 pts. 11,438
  8. Avatar for KarenCH 8. KarenCH Lv 1 80 pts. 11,438
  9. Avatar for malphis 9. malphis Lv 1 77 pts. 11,433
  10. Avatar for guineapig 10. guineapig Lv 1 74 pts. 11,415

Comments