Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for Deleted player
    1. Deleted player
    pts. 12,501
  2. Avatar for Xartos 2. Xartos Lv 1 97 pts. 12,479
  3. Avatar for grogar7 3. grogar7 Lv 1 94 pts. 12,469
  4. Avatar for g_b 4. g_b Lv 1 91 pts. 12,435
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 88 pts. 12,397
  6. Avatar for LociOiling 6. LociOiling Lv 1 85 pts. 12,383
  7. Avatar for mirp 7. mirp Lv 1 82 pts. 12,383
  8. Avatar for malphis 8. malphis Lv 1 79 pts. 12,359
  9. Avatar for MicElephant 9. MicElephant Lv 1 76 pts. 12,353
  10. Avatar for silent gene 10. silent gene Lv 1 74 pts. 12,333

Comments