1878: Refinement Puzzle: R1034
Closed since over 5 years ago
Novice Overall PredictionSummary
- Created
- August 13, 2020
- Expires
- Max points
- 100
CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!
Sequence:
LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI
Top groups
-
pts. 12,501
-
-
-
-
-
-
-
-
-