Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups


  1. Avatar for Go Science 100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403

  1. Avatar for Deleted player pts. 12,501
  2. Avatar for Xartos 2. Xartos Lv 1 97 pts. 12,479
  3. Avatar for grogar7 3. grogar7 Lv 1 94 pts. 12,469
  4. Avatar for g_b 4. g_b Lv 1 91 pts. 12,435
  5. Avatar for ZeroLeak7 5. ZeroLeak7 Lv 1 88 pts. 12,397
  6. Avatar for LociOiling 6. LociOiling Lv 1 85 pts. 12,383
  7. Avatar for mirp 7. mirp Lv 1 82 pts. 12,383
  8. Avatar for malphis 8. malphis Lv 1 79 pts. 12,359
  9. Avatar for MicElephant 9. MicElephant Lv 1 76 pts. 12,353
  10. Avatar for silent gene 10. silent gene Lv 1 74 pts. 12,333

Comments