Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for ichwilldiesennamen
    1. ichwilldiesennamen Lv 1
    100 pts. 12,516
  2. Avatar for Galaxie 2. Galaxie Lv 1 81 pts. 12,499
  3. Avatar for zo3xiaJonWeinberg 3. zo3xiaJonWeinberg Lv 1 65 pts. 12,496
  4. Avatar for mirp 4. mirp Lv 1 52 pts. 12,494
  5. Avatar for Dhalion 5. Dhalion Lv 1 41 pts. 12,493
  6. Avatar for silent gene 6. silent gene Lv 1 32 pts. 12,492
  7. Avatar for Czim 7. Czim Lv 1 24 pts. 12,491
  8. Avatar for Xartos 8. Xartos Lv 1 18 pts. 12,491
  9. Avatar for robgee 9. robgee Lv 1 14 pts. 12,469
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 10 pts. 12,446

Comments