Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,347
  2. Avatar for Russian team 12. Russian team 1 pt. 11,231
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 11,055
  4. Avatar for Team Canada 14. Team Canada 1 pt. 10,720
  5. Avatar for Window Group 15. Window Group 1 pt. 7,013
  6. Avatar for Macromolecules@MQ 2020 16. Macromolecules@MQ 2020 1 pt. 6,897
  1. Avatar for ichwilldiesennamen
    1. ichwilldiesennamen Lv 1
    100 pts. 12,516
  2. Avatar for Galaxie 2. Galaxie Lv 1 81 pts. 12,499
  3. Avatar for zo3xiaJonWeinberg 3. zo3xiaJonWeinberg Lv 1 65 pts. 12,496
  4. Avatar for mirp 4. mirp Lv 1 52 pts. 12,494
  5. Avatar for Dhalion 5. Dhalion Lv 1 41 pts. 12,493
  6. Avatar for silent gene 6. silent gene Lv 1 32 pts. 12,492
  7. Avatar for Czim 7. Czim Lv 1 24 pts. 12,491
  8. Avatar for Xartos 8. Xartos Lv 1 18 pts. 12,491
  9. Avatar for robgee 9. robgee Lv 1 14 pts. 12,469
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 10 pts. 12,446

Comments