Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403
  1. Avatar for alwen 11. alwen Lv 1 7 pts. 12,432
  2. Avatar for phi16 12. phi16 Lv 1 5 pts. 12,425
  3. Avatar for Deleted player 13. Deleted player 4 pts. 12,375
  4. Avatar for LociOiling 14. LociOiling Lv 1 3 pts. 12,365
  5. Avatar for MicElephant 15. MicElephant Lv 1 2 pts. 12,354
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 1 pt. 12,255
  7. Avatar for borattt 17. borattt Lv 1 1 pt. 12,250
  8. Avatar for CharlieFortsConscience 18. CharlieFortsConscience Lv 1 1 pt. 12,190
  9. Avatar for fisherlr777 19. fisherlr777 Lv 1 1 pt. 12,086
  10. Avatar for puxatudo 20. puxatudo Lv 1 1 pt. 12,026

Comments