Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups


  1. Avatar for Go Science 100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403

  1. Avatar for sitlux 111. sitlux Lv 1 1 pt. 10,658
  2. Avatar for cjddig 112. cjddig Lv 1 1 pt. 10,640
  3. Avatar for xbp 113. xbp Lv 1 1 pt. 10,610
  4. Avatar for zeluis 114. zeluis Lv 1 1 pt. 10,595
  5. Avatar for AlkiP0Ps 115. AlkiP0Ps Lv 1 1 pt. 10,591
  6. Avatar for roman madala 116. roman madala Lv 1 1 pt. 10,575
  7. Avatar for Kevonni 117. Kevonni Lv 1 1 pt. 10,556
  8. Avatar for fearjuan 118. fearjuan Lv 1 1 pt. 10,542
  9. Avatar for Mohoernchen 119. Mohoernchen Lv 1 1 pt. 10,538
  10. Avatar for tzugypsyl 120. tzugypsyl Lv 1 1 pt. 10,536

Comments