Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups


  1. Avatar for Go Science 100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403

  1. Avatar for Vinara 51. Vinara Lv 1 13 pts. 11,590
  2. Avatar for infjamc 52. infjamc Lv 1 13 pts. 11,557
  3. Avatar for equilibria 53. equilibria Lv 1 12 pts. 11,547
  4. Avatar for drumpeter18yrs9yrs 54. drumpeter18yrs9yrs Lv 1 12 pts. 11,526
  5. Avatar for alcor29 55. alcor29 Lv 1 11 pts. 11,470
  6. Avatar for GuR0 56. GuR0 Lv 1 10 pts. 11,443
  7. Avatar for Tygh 57. Tygh Lv 1 10 pts. 11,405
  8. Avatar for aendgraend 58. aendgraend Lv 1 9 pts. 11,403
  9. Avatar for martinzblavy 59. martinzblavy Lv 1 9 pts. 11,401
  10. Avatar for abiogenesis 60. abiogenesis Lv 1 9 pts. 11,383

Comments