Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups


  1. Avatar for Go Science 100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403

  1. Avatar for JasperD 61. JasperD Lv 1 8 pts. 11,347
  2. Avatar for Trajan464 62. Trajan464 Lv 1 8 pts. 11,332
  3. Avatar for BarrySampson 63. BarrySampson Lv 1 7 pts. 11,321
  4. Avatar for kludbrook 64. kludbrook Lv 1 7 pts. 11,297
  5. Avatar for foobar23 65. foobar23 Lv 1 7 pts. 11,274
  6. Avatar for jawz101 66. jawz101 Lv 1 6 pts. 11,271
  7. Avatar for rezaefar 67. rezaefar Lv 1 6 pts. 11,262
  8. Avatar for cbwest 68. cbwest Lv 1 6 pts. 11,249
  9. Avatar for Hellcat6 69. Hellcat6 Lv 1 5 pts. 11,233
  10. Avatar for kyoota 70. kyoota Lv 1 5 pts. 11,231

Comments