Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,519
  2. Avatar for Russian team 12. Russian team 1 pt. 11,206
  3. Avatar for Team Canada 13. Team Canada 1 pt. 10,862
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 10,665
  5. Avatar for Aalborghus 15. Aalborghus 1 pt. 10,137
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 12,990
  2. Avatar for mirp 2. mirp Lv 1 97 pts. 12,640
  3. Avatar for Xartos 3. Xartos Lv 1 94 pts. 12,600
  4. Avatar for malphis 4. malphis Lv 1 91 pts. 12,500
  5. Avatar for spmm 5. spmm Lv 1 88 pts. 12,454
  6. Avatar for jobo0502 6. jobo0502 Lv 1 85 pts. 12,454
  7. Avatar for Deleted player 7. Deleted player pts. 12,407
  8. Avatar for ichwilldiesennamen 8. ichwilldiesennamen Lv 1 79 pts. 12,365
  9. Avatar for guineapig 9. guineapig Lv 1 76 pts. 12,349
  10. Avatar for MicElephant 10. MicElephant Lv 1 74 pts. 12,345

Comments