Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 11,519
  2. Avatar for Russian team 12. Russian team 1 pt. 11,206
  3. Avatar for Team Canada 13. Team Canada 1 pt. 10,862
  4. Avatar for Minions of TWIS 14. Minions of TWIS 1 pt. 10,665
  5. Avatar for Aalborghus 15. Aalborghus 1 pt. 10,137
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 12,990
  2. Avatar for mirp 2. mirp Lv 1 97 pts. 12,640
  3. Avatar for Xartos 3. Xartos Lv 1 94 pts. 12,600
  4. Avatar for malphis 4. malphis Lv 1 91 pts. 12,500
  5. Avatar for spmm 5. spmm Lv 1 88 pts. 12,454
  6. Avatar for jobo0502 6. jobo0502 Lv 1 85 pts. 12,454
  7. Avatar for Deleted player 7. Deleted player pts. 12,407
  8. Avatar for ichwilldiesennamen 8. ichwilldiesennamen Lv 1 79 pts. 12,365
  9. Avatar for guineapig 9. guineapig Lv 1 76 pts. 12,349
  10. Avatar for MicElephant 10. MicElephant Lv 1 74 pts. 12,345

Comments