Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569

  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 12,990
  2. Avatar for mirp 2. mirp Lv 1 97 pts. 12,640
  3. Avatar for Xartos 3. Xartos Lv 1 94 pts. 12,600
  4. Avatar for malphis 4. malphis Lv 1 91 pts. 12,500
  5. Avatar for spmm 5. spmm Lv 1 88 pts. 12,454
  6. Avatar for jobo0502 6. jobo0502 Lv 1 85 pts. 12,454
  7. Avatar for Deleted player 7. Deleted player pts. 12,407
  8. Avatar for ichwilldiesennamen 8. ichwilldiesennamen Lv 1 79 pts. 12,365
  9. Avatar for guineapig 9. guineapig Lv 1 76 pts. 12,349
  10. Avatar for MicElephant 10. MicElephant Lv 1 74 pts. 12,345

Comments