Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569
  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 12,920
  2. Avatar for phi16 2. phi16 Lv 1 84 pts. 12,891
  3. Avatar for robgee 3. robgee Lv 1 70 pts. 12,759
  4. Avatar for alcor29 4. alcor29 Lv 1 58 pts. 12,754
  5. Avatar for MrZanav 5. MrZanav Lv 1 48 pts. 12,739
  6. Avatar for Deleted player 6. Deleted player pts. 12,722
  7. Avatar for ichwilldiesennamen 7. ichwilldiesennamen Lv 1 32 pts. 12,706
  8. Avatar for Xartos 8. Xartos Lv 1 26 pts. 12,678
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 20 pts. 12,678
  10. Avatar for mirp 10. mirp Lv 1 16 pts. 12,677

Comments