Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569

  1. Avatar for Dhalion 11. Dhalion Lv 1 13 pts. 12,674
  2. Avatar for Czim 12. Czim Lv 1 10 pts. 12,668
  3. Avatar for puxatudo 13. puxatudo Lv 1 7 pts. 12,665
  4. Avatar for silent gene 14. silent gene Lv 1 6 pts. 12,659
  5. Avatar for borattt 15. borattt Lv 1 4 pts. 12,650
  6. Avatar for Phyx 16. Phyx Lv 1 3 pts. 12,519
  7. Avatar for LociOiling 17. LociOiling Lv 1 2 pts. 12,314
  8. Avatar for Alistair69 18. Alistair69 Lv 1 2 pts. 12,306
  9. Avatar for manu8170 19. manu8170 Lv 1 1 pt. 12,302
  10. Avatar for Deleted player 20. Deleted player 1 pt. 12,280

Comments