Placeholder image of a protein
Icon representing a puzzle

1881: Refinement Target: R1068

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 21, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,990
  2. Avatar for Go Science 2. Go Science 70 pts. 12,706
  3. Avatar for Void Crushers 3. Void Crushers 47 pts. 12,454
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 12,454
  5. Avatar for Beta Folders 5. Beta Folders 19 pts. 12,328
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 12,116
  7. Avatar for Contenders 7. Contenders 7 pts. 12,114
  8. Avatar for Marvin's bunch 8. Marvin's bunch 4 pts. 12,040
  9. Avatar for BOINC@Poland 9. BOINC@Poland 2 pts. 11,640
  10. Avatar for Hold My Beer 10. Hold My Beer 1 pt. 11,569

  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 1 pt. 12,114
  2. Avatar for OWM3 22. OWM3 Lv 1 1 pt. 12,099
  3. Avatar for Jpilkington 23. Jpilkington Lv 1 1 pt. 12,087
  4. Avatar for HuubR 24. HuubR Lv 1 1 pt. 12,046
  5. Avatar for fpc 25. fpc Lv 1 1 pt. 12,040
  6. Avatar for nicobul 26. nicobul Lv 1 1 pt. 12,014
  7. Avatar for BootsMcGraw 27. BootsMcGraw Lv 1 1 pt. 11,950
  8. Avatar for georg137 29. georg137 Lv 1 1 pt. 11,900
  9. Avatar for KarenCH 30. KarenCH Lv 1 1 pt. 11,582

Comments