1881: Refinement Target: R1068
Closed since over 5 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- August 21, 2020
- Expires
- Max points
- 100
CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!
Sequence:
QRHVQLNPELRFERPDKEYIPLPPLRDMQDMVKVLFLLSTDKKRYPDGRHRTLDYFRVAVEMFVTEVRQEYKRQYQQAQRNGRAMQRFTWKNSGELAICFACCCDNVKLLYDSLQPGPLKPLWDAFVGQLPPMLIVQSRVPETMLSSQTYHTKYMDWVKGGTRYGGEQSTANVRFPSVADRRVKVETYLRS
Top groups
-
100 pts. 12,990
-
-
-
-
-
-
-
-
-