Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups


  1. Avatar for Russian team 11. Russian team 1 pt. 10,229
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,014
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 9,876
  4. Avatar for Team Canada 14. Team Canada 1 pt. 9,749
  5. Avatar for Italiani Al Lavoro 15. Italiani Al Lavoro 1 pt. 9,540
  6. Avatar for Window Group 16. Window Group 1 pt. 5,982
  7. Avatar for Foldit Staff 17. Foldit Staff 1 pt. 3,477

  1. Avatar for 01010011111 151. 01010011111 Lv 1 1 pt. 4,538
  2. Avatar for bkoep 152. bkoep Lv 1 1 pt. 3,477
  3. Avatar for puxatudo 153. puxatudo Lv 1 1 pt. 3,477
  4. Avatar for foldyfold 154. foldyfold Lv 1 1 pt. 3,477
  5. Avatar for Deleted player 155. Deleted player pts. 3,477
  6. Avatar for agujas 156. agujas Lv 1 1 pt. 3,477
  7. Avatar for Psych0Active 157. Psych0Active Lv 1 1 pt. 3,477
  8. Avatar for rk7467 158. rk7467 Lv 1 1 pt. 3,477

Comments