Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,440
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,311
  3. Avatar for Russian team 13. Russian team 1 pt. 8,984
  4. Avatar for Team Canada 14. Team Canada 1 pt. 8,801
  1. Avatar for kludbrook 101. kludbrook Lv 1 1 pt. 8,728
  2. Avatar for drumpeter18yrs9yrs 102. drumpeter18yrs9yrs Lv 1 1 pt. 8,714
  3. Avatar for zannipietro 103. zannipietro Lv 1 1 pt. 8,703
  4. Avatar for cjddig 104. cjddig Lv 1 1 pt. 8,669
  5. Avatar for Tifdaff 105. Tifdaff Lv 1 1 pt. 8,662
  6. Avatar for WolverineX 106. WolverineX Lv 1 1 pt. 8,634
  7. Avatar for nathalie friess salido 107. nathalie friess salido Lv 1 1 pt. 8,620
  8. Avatar for Beany 108. Beany Lv 1 1 pt. 8,614
  9. Avatar for HuubR 109. HuubR Lv 1 1 pt. 8,610
  10. Avatar for Mohoernchen 110. Mohoernchen Lv 1 1 pt. 8,581

Comments