Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,440
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,311
  3. Avatar for Russian team 13. Russian team 1 pt. 8,984
  4. Avatar for Team Canada 14. Team Canada 1 pt. 8,801
  1. Avatar for Javasharp 121. Javasharp Lv 1 1 pt. 8,321
  2. Avatar for AlkiP0Ps 122. AlkiP0Ps Lv 1 1 pt. 8,317
  3. Avatar for Psych0Active 123. Psych0Active Lv 1 1 pt. 8,303
  4. Avatar for roman madala 124. roman madala Lv 1 1 pt. 8,296
  5. Avatar for HMK 125. HMK Lv 1 1 pt. 8,237
  6. Avatar for tlaran 126. tlaran Lv 1 1 pt. 8,226
  7. Avatar for BPS_robertaproietto_2020 127. BPS_robertaproietto_2020 Lv 1 1 pt. 8,220
  8. Avatar for Martin003 128. Martin003 Lv 1 1 pt. 8,215
  9. Avatar for JoyG123 129. JoyG123 Lv 1 1 pt. 8,182
  10. Avatar for Tans8b07 130. Tans8b07 Lv 1 1 pt. 8,166

Comments