Placeholder image of a protein
Icon representing a puzzle

1887: Refinement Target: R1091

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 04, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SDPLTVPVEVEWQGVTGARTVITADQPSNVELKLVQKNKNGGSDNQDYRKTNVNVSKNVSNETRNFEKVAKGYQYDLIAPDVPAFTKEIKNVGTESNPSFKVIYKQL

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,440
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 9,311
  3. Avatar for Russian team 13. Russian team 1 pt. 8,984
  4. Avatar for Team Canada 14. Team Canada 1 pt. 8,801
  1. Avatar for g_b 21. g_b Lv 1 48 pts. 10,806
  2. Avatar for nicobul 22. nicobul Lv 1 46 pts. 10,776
  3. Avatar for Galaxie 23. Galaxie Lv 1 44 pts. 10,766
  4. Avatar for BootsMcGraw 24. BootsMcGraw Lv 1 42 pts. 10,763
  5. Avatar for aznarog 25. aznarog Lv 1 40 pts. 10,747
  6. Avatar for malphis 26. malphis Lv 1 39 pts. 10,741
  7. Avatar for martinzblavy 27. martinzblavy Lv 1 37 pts. 10,733
  8. Avatar for Keresto 28. Keresto Lv 1 36 pts. 10,728
  9. Avatar for spmm 29. spmm Lv 1 34 pts. 10,728
  10. Avatar for guineapig 30. guineapig Lv 1 33 pts. 10,721

Comments