Placeholder image of a protein
Icon representing a puzzle

1890: Revisiting Puzzle 136: Cell Adhesion

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 11, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 8,213
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 8,081
  3. Avatar for Team Canada 13. Team Canada 1 pt. 7,876
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 7,576
  5. Avatar for CH4110 Fold it! 15. CH4110 Fold it! 1 pt. 7,354
  6. Avatar for Weber CHM3010 F2020 16. Weber CHM3010 F2020 1 pt. 7,055
  7. Avatar for Window Group 17. Window Group 1 pt. 5,755
  8. Avatar for Foldit Staff 18. Foldit Staff 1 pt. 5,091
  1. Avatar for pasiphae 121. pasiphae Lv 1 1 pt. 7,260
  2. Avatar for EagleGuy 122. EagleGuy Lv 1 1 pt. 7,258
  3. Avatar for JEAUSSIE7 123. JEAUSSIE7 Lv 1 1 pt. 7,216
  4. Avatar for Agadius 124. Agadius Lv 1 1 pt. 7,140
  5. Avatar for Primalsoul 125. Primalsoul Lv 1 1 pt. 7,132
  6. Avatar for ians2 126. ians2 Lv 1 1 pt. 7,107
  7. Avatar for shadow02 127. shadow02 Lv 1 1 pt. 7,102
  8. Avatar for drumpeter18yrs9yrs 128. drumpeter18yrs9yrs Lv 1 1 pt. 7,062
  9. Avatar for Koustav Saha 129. Koustav Saha Lv 1 1 pt. 7,059
  10. Avatar for CJ_Pearosn 130. CJ_Pearosn Lv 1 1 pt. 7,055

Comments

spmm Lv 1

This seems to be one of the old puzzles with a locked seg which can’t be moved by hand - even on low CI .

bkoep Staff Lv 1

Segment 25 should not be locked. Can you give some more details about the issue?

Can you move that segment with the Pull tool, or the Move tool, or the Rama Map?