Placeholder image of a protein
Icon representing a puzzle

1890: Revisiting Puzzle 136: Cell Adhesion

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 11, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Go Science 100 pts. 9,958
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,871
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,864
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 9,813
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,764
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,745
  7. Avatar for Contenders 7. Contenders 12 pts. 9,713
  8. Avatar for Hold My Beer 8. Hold My Beer 8 pts. 9,039
  9. Avatar for Trinity Biology 9. Trinity Biology 5 pts. 8,618
  10. Avatar for Russian team 10. Russian team 3 pts. 8,422

  1. Avatar for pasiphae 121. pasiphae Lv 1 1 pt. 7,260
  2. Avatar for EagleGuy 122. EagleGuy Lv 1 1 pt. 7,258
  3. Avatar for JEAUSSIE7 123. JEAUSSIE7 Lv 1 1 pt. 7,216
  4. Avatar for Agadius 124. Agadius Lv 1 1 pt. 7,140
  5. Avatar for Primalsoul 125. Primalsoul Lv 1 1 pt. 7,132
  6. Avatar for ians2 126. ians2 Lv 1 1 pt. 7,107
  7. Avatar for shadow02 127. shadow02 Lv 1 1 pt. 7,102
  8. Avatar for drumpeter18yrs9yrs 128. drumpeter18yrs9yrs Lv 1 1 pt. 7,062
  9. Avatar for Koustav Saha 129. Koustav Saha Lv 1 1 pt. 7,059
  10. Avatar for CJ_Pearosn 130. CJ_Pearosn Lv 1 1 pt. 7,055

Comments


spmm Lv 1

This seems to be one of the old puzzles with a locked seg which can’t be moved by hand - even on low CI .

bkoep Staff Lv 1

Segment 25 should not be locked. Can you give some more details about the issue?

Can you move that segment with the Pull tool, or the Move tool, or the Rama Map?