Placeholder image of a protein
Icon representing a puzzle

1890: Revisiting Puzzle 136: Cell Adhesion

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 11, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,958
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,871
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,864
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 9,813
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,764
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,745
  7. Avatar for Contenders 7. Contenders 12 pts. 9,713
  8. Avatar for Hold My Beer 8. Hold My Beer 8 pts. 9,039
  9. Avatar for Trinity Biology 9. Trinity Biology 5 pts. 8,618
  10. Avatar for Russian team 10. Russian team 3 pts. 8,422
  1. Avatar for jflat06 141. jflat06 Lv 1 1 pt. 5,755
  2. Avatar for harvardman 142. harvardman Lv 1 1 pt. 5,717
  3. Avatar for Just a theory 143. Just a theory Lv 1 1 pt. 5,099
  4. Avatar for bkoep 144. bkoep Lv 1 1 pt. 5,091
  5. Avatar for I Wismeijer 145. I Wismeijer Lv 1 1 pt. 5,091
  6. Avatar for Annaromac 146. Annaromac Lv 1 1 pt. 5,091
  7. Avatar for jjinwldls 147. jjinwldls Lv 1 1 pt. 5,091
  8. Avatar for pilousmi 148. pilousmi Lv 1 1 pt. 5,091
  9. Avatar for Superphosphate 149. Superphosphate Lv 1 1 pt. 5,091
  10. Avatar for graceconnolly 150. graceconnolly Lv 1 1 pt. 5,091

Comments

spmm Lv 1

This seems to be one of the old puzzles with a locked seg which can’t be moved by hand - even on low CI .

bkoep Staff Lv 1

Segment 25 should not be locked. Can you give some more details about the issue?

Can you move that segment with the Pull tool, or the Move tool, or the Rama Map?