Placeholder image of a protein
Icon representing a puzzle

1890: Revisiting Puzzle 136: Cell Adhesion

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
September 11, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,958
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,871
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,864
  4. Avatar for Gargleblasters 4. Gargleblasters 38 pts. 9,813
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,764
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,745
  7. Avatar for Contenders 7. Contenders 12 pts. 9,713
  8. Avatar for Hold My Beer 8. Hold My Beer 8 pts. 9,039
  9. Avatar for Trinity Biology 9. Trinity Biology 5 pts. 8,618
  10. Avatar for Russian team 10. Russian team 3 pts. 8,422
  1. Avatar for Beany 81. Beany Lv 1 3 pts. 8,281
  2. Avatar for tracybutt 82. tracybutt Lv 1 3 pts. 8,271
  3. Avatar for Trajan464 83. Trajan464 Lv 1 3 pts. 8,230
  4. Avatar for argyrw 84. argyrw Lv 1 3 pts. 8,225
  5. Avatar for dldahlen 85. dldahlen Lv 1 2 pts. 8,220
  6. Avatar for pfirth 86. pfirth Lv 1 2 pts. 8,216
  7. Avatar for Dr.Sillem 87. Dr.Sillem Lv 1 2 pts. 8,216
  8. Avatar for ShadowTactics 88. ShadowTactics Lv 1 2 pts. 8,213
  9. Avatar for wisky 89. wisky Lv 1 2 pts. 8,154
  10. Avatar for chris69300 90. chris69300 Lv 1 2 pts. 8,154

Comments

spmm Lv 1

This seems to be one of the old puzzles with a locked seg which can’t be moved by hand - even on low CI .

bkoep Staff Lv 1

Segment 25 should not be locked. Can you give some more details about the issue?

Can you move that segment with the Pull tool, or the Move tool, or the Rama Map?