Placeholder image of a protein
Icon representing a puzzle

1893: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Beta Folders 100 pts. 11,789
  2. Avatar for Go Science 2. Go Science 73 pts. 11,642
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 11,598
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 11,587
  5. Avatar for Contenders 5. Contenders 24 pts. 11,469
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 11,460
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,411
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 6 pts. 11,407
  9. Avatar for Russian team 9. Russian team 4 pts. 11,081
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 10,919

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,784
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 97 pts. 11,642
  3. Avatar for mirp 3. mirp Lv 1 94 pts. 11,620
  4. Avatar for Xartos 4. Xartos Lv 1 91 pts. 11,603
  5. Avatar for jobo0502 5. jobo0502 Lv 1 88 pts. 11,587
  6. Avatar for grogar7 6. grogar7 Lv 1 85 pts. 11,583
  7. Avatar for Deleted player 7. Deleted player pts. 11,576
  8. Avatar for dcrwheeler 8. dcrwheeler Lv 1 80 pts. 11,568
  9. Avatar for ichwilldiesennamen 9. ichwilldiesennamen Lv 1 77 pts. 11,563
  10. Avatar for pauldunn 10. pauldunn Lv 1 75 pts. 11,560

Comments