Placeholder image of a protein
Icon representing a puzzle

1893: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
September 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Team Canada 11. Team Canada 1 pt. 10,856
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 10,848
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,698
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,998
  5. Avatar for Window Group 15. Window Group 1 pt. 8,509
  6. Avatar for Schoko 17. Schoko 1 pt. 8,438

  1. Avatar for Superphosphate 121. Superphosphate Lv 1 1 pt. 10,098
  2. Avatar for ivalnic 122. ivalnic Lv 1 1 pt. 10,092
  3. Avatar for Jan Marquardt 123. Jan Marquardt Lv 1 1 pt. 10,072
  4. Avatar for pmnbr 124. pmnbr Lv 1 1 pt. 10,061
  5. Avatar for hajtogato 125. hajtogato Lv 1 1 pt. 10,061
  6. Avatar for multaq 126. multaq Lv 1 1 pt. 10,059
  7. Avatar for AlkiP0Ps 127. AlkiP0Ps Lv 1 1 pt. 10,016
  8. Avatar for Giantbluefish 128. Giantbluefish Lv 1 1 pt. 10,009
  9. Avatar for HMK 129. HMK Lv 1 1 pt. 9,998
  10. Avatar for pfirth 130. pfirth Lv 1 1 pt. 9,989

Comments