Placeholder image of a protein
Icon representing a puzzle

1893: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 5 years ago

Novice Overall Prediction

Summary


Created
September 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Team Canada 11. Team Canada 1 pt. 10,856
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 10,848
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 10,698
  4. Avatar for SETI.Germany 14. SETI.Germany 1 pt. 9,998
  5. Avatar for Window Group 15. Window Group 1 pt. 8,509
  6. Avatar for Schoko 17. Schoko 1 pt. 8,438

  1. Avatar for KarenCH 21. KarenCH Lv 1 51 pts. 11,429
  2. Avatar for GuR0 22. GuR0 Lv 1 49 pts. 11,414
  3. Avatar for fpc 23. fpc Lv 1 47 pts. 11,411
  4. Avatar for Hiro Protagonist 24. Hiro Protagonist Lv 1 46 pts. 11,407
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 44 pts. 11,390
  6. Avatar for g_b 26. g_b Lv 1 42 pts. 11,384
  7. Avatar for Blipperman 27. Blipperman Lv 1 41 pts. 11,382
  8. Avatar for Keresto 28. Keresto Lv 1 39 pts. 11,358
  9. Avatar for Bletchley Park 29. Bletchley Park Lv 1 38 pts. 11,357
  10. Avatar for johnmitch 30. johnmitch Lv 1 36 pts. 11,351

Comments