Placeholder image of a protein
Icon representing a puzzle

1893: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Beta Folders 100 pts. 11,789
  2. Avatar for Go Science 2. Go Science 73 pts. 11,642
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 11,598
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 11,587
  5. Avatar for Contenders 5. Contenders 24 pts. 11,469
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 11,460
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,411
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 6 pts. 11,407
  9. Avatar for Russian team 9. Russian team 4 pts. 11,081
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 10,919

  1. Avatar for ShadowTactics 91. ShadowTactics Lv 1 2 pts. 10,698
  2. Avatar for Altercomp 92. Altercomp Lv 1 2 pts. 10,696
  3. Avatar for Deleted player 93. Deleted player pts. 10,694
  4. Avatar for infjamc 94. infjamc Lv 1 2 pts. 10,686
  5. Avatar for JasperD 95. JasperD Lv 1 1 pt. 10,653
  6. Avatar for abiogenesis 96. abiogenesis Lv 1 1 pt. 10,633
  7. Avatar for kludbrook 97. kludbrook Lv 1 1 pt. 10,597
  8. Avatar for Todd6485577 98. Todd6485577 Lv 1 1 pt. 10,590
  9. Avatar for heyubob 99. heyubob Lv 1 1 pt. 10,588
  10. Avatar for ClassicShyGuy 100. ClassicShyGuy Lv 1 1 pt. 10,573

Comments