Placeholder image of a protein
Icon representing a puzzle

1893: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 5 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
September 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Beta Folders 100 pts. 11,789
  2. Avatar for Go Science 2. Go Science 73 pts. 11,642
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 11,598
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 11,587
  5. Avatar for Contenders 5. Contenders 24 pts. 11,469
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 11,460
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,411
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 6 pts. 11,407
  9. Avatar for Russian team 9. Russian team 4 pts. 11,081
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 10,919

  1. Avatar for BlueEqualsRed 131. BlueEqualsRed Lv 1 1 pt. 9,962
  2. Avatar for fabiodavilla 132. fabiodavilla Lv 1 1 pt. 9,955
  3. Avatar for deathbat_87 133. deathbat_87 Lv 1 1 pt. 9,950
  4. Avatar for wisky 134. wisky Lv 1 1 pt. 9,943
  5. Avatar for becaillouet2020 135. becaillouet2020 Lv 1 1 pt. 9,779
  6. Avatar for Jujuuu 136. Jujuuu Lv 1 1 pt. 9,631
  7. Avatar for seven7 137. seven7 Lv 1 1 pt. 9,423
  8. Avatar for Makuru 138. Makuru Lv 1 1 pt. 9,349
  9. Avatar for drumpeter18yrs9yrs 139. drumpeter18yrs9yrs Lv 1 1 pt. 9,346
  10. Avatar for Barium56 140. Barium56 Lv 1 1 pt. 9,339

Comments