Placeholder image of a protein
Icon representing a puzzle

1893: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 5 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
September 18, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Beta Folders 100 pts. 11,789
  2. Avatar for Go Science 2. Go Science 73 pts. 11,642
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 11,598
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 11,587
  5. Avatar for Contenders 5. Contenders 24 pts. 11,469
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 11,460
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,411
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 6 pts. 11,407
  9. Avatar for Russian team 9. Russian team 4 pts. 11,081
  10. Avatar for Void Crushers 10. Void Crushers 2 pts. 10,919

  1. Avatar for Vinara 81. Vinara Lv 1 3 pts. 10,850
  2. Avatar for Steven Pletsch 82. Steven Pletsch Lv 1 3 pts. 10,848
  3. Avatar for argyrw 83. argyrw Lv 1 3 pts. 10,845
  4. Avatar for haggisfam 84. haggisfam Lv 1 3 pts. 10,842
  5. Avatar for joremen 85. joremen Lv 1 3 pts. 10,814
  6. Avatar for tracybutt 86. tracybutt Lv 1 2 pts. 10,813
  7. Avatar for CAN1958 87. CAN1958 Lv 1 2 pts. 10,804
  8. Avatar for Hellcat6 88. Hellcat6 Lv 1 2 pts. 10,770
  9. Avatar for MrZanav 89. MrZanav Lv 1 2 pts. 10,766
  10. Avatar for Ashrai 90. Ashrai Lv 1 2 pts. 10,725

Comments