Placeholder image of a protein
Icon representing a puzzle

1919: Revisiting Puzzle 143: Rosetta Decoy 7

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
November 19, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This enzyme helps to regenerate a cofactor that is necessary for nucleic acid synthesis; the starting structure is a model produced by Rosetta. This protein contains only one cysteine, so no disulfide bonds are expected. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ATFGMGDRVRKKSGAAWQGQIVGWYCTNLTPEGYAVESEAHPGSVQIYPVAALERI

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 2 pts. 9,206
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 9,060
  3. Avatar for Gruppo notte dei ricercatori 13. Gruppo notte dei ricercatori 1 pt. 9,059
  4. Avatar for Hold My Beer 14. Hold My Beer 1 pt. 8,958
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 8,562
  6. Avatar for Window Group 16. Window Group 1 pt. 8,520
  7. Avatar for Fox Folds 17. Fox Folds 1 pt. 8,277
  8. Avatar for Biochimica generale - Medicina RA 18. Biochimica generale - Medicina RA 1 pt. 8,277
  1. Avatar for dcrwheeler 21. dcrwheeler Lv 1 53 pts. 9,652
  2. Avatar for KarenCH 22. KarenCH Lv 1 51 pts. 9,649
  3. Avatar for fiendish_ghoul 23. fiendish_ghoul Lv 1 49 pts. 9,647
  4. Avatar for g_b 24. g_b Lv 1 48 pts. 9,642
  5. Avatar for drjr 25. drjr Lv 1 46 pts. 9,630
  6. Avatar for martin.kendig@verizon.net 26. martin.kendig@verizon.net Lv 1 44 pts. 9,623
  7. Avatar for Timo van der Laan 27. Timo van der Laan Lv 1 43 pts. 9,605
  8. Avatar for BootsMcGraw 28. BootsMcGraw Lv 1 41 pts. 9,601
  9. Avatar for silent gene 29. silent gene Lv 1 40 pts. 9,598
  10. Avatar for Galaxie 30. Galaxie Lv 1 39 pts. 9,586

Comments